Publikationen (Lehrstuhl)

Ergebnisse exportiert:
Buch- und Zeitschriftenbeiträge
Peschel, M. (2009). Alleine geht es gut, zusammen manchmal besser! – Kooperationen im Sachunterricht beim Experimentieren. In Sache – Wort – Zahl (SWZ) (Bd. Heft 101, 04/2009, 37 Jhg., S. 23-27). Aulis Verlag.
PDF icon Peschel, M. (2009). Alleine geht es gut, zusammen manchmal besser!.pdf (7.55 MB)
Kelkel, M., Schumacher, M., Dicato, M., & Diederich, M.. (2011). Antioxidant and anti-proliferative properties of lycopene. In Free Radical Research (8. Aufl., Bd. 45, S. 925-940). doi: 10.3109/10715762.2011.564168
PDF icon Kelkel, Schumacher, Dicato, Diederich (2011). Antioxidant and anti-proliferative properties of lycopene.pdf (447.21 KB)
Peschel, M. (2009). Aus- und Fortbildungen für den naturwissenschaftlich-physikalischen Sachunterricht. In R. Lauterbach, Giest, H., & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 149-156). Bad Heilbrunn: Klinkhardt.
Peschel, M. (2014). Außerschulische Lernorte in der Sachunterrichtsausbildung. In D. Brovelli, Fuchs, K., Rempfler, A., & Häller, B. Sommer (Hrsg.), Ausserschulische Lernorte – Impulse aus der Praxis (S. 131-136). Berlin: LIT.
Kihm, P., Knopf, J., & Ladel, S.. (2015). „Cu l8er – Cu2 :-)" – Was Kinder aus der SMS-Kommunikation lernen können.. In Grundschulunterricht Mathematik (Bd. 01, S. 19-22). Oldenbourg Schulbuchverlag.
PDF icon Peschel (2012) Geldautomat.PDF (624.31 KB)
Peschel, M. (2006). Das Mobile Computerlabor. Konzeption und Anwendungen. In V. Nordmeier & Oberländer, A. (Hrsg.), Didaktik der Physik Kassel. Berlin: Lehmanns Media.
Peschel, M., & Struzyna, S.. (2010). Das Raumkonzept des Grundschullabors zum Offenen Experimentieren als Element der Öffnung. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 458-460). Berln: LIT. Abgerufen von
PDF icon PeschelStruzyna (2010) GOFEX - Der Raum als Element der Öffnung.pdf (4.36 MB)
PDF icon Decrypting the labyrinth of inflammatory cell signaling pathways.pdf (67.68 KB)
Peschel, M., Fröhler, N., Hürtgen, S., Schlüter, C., & Thiedke, M.. (2004). „Demokratie beginnt in der Schule..auch nach PISA..!?“, Ergebnisse von PISA 2000. In Wir können auch anders. Perspektiven von Demokratie und Partizipation (Schriftenreihe Hans-Böckler-Stiftung.). Dampfboot-Verlag.
Peschel, M. (2009). Der Begriff der Offenheit beim Offenen Experimentieren. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 268-270). Berlin: LIT.
PDF icon Peschel (2009) Der Begriff der Offenheit beim Offenen Experimentieren.pdf (3.82 MB)
Peschel, M. (2006). Der Computer zur Präsentation von Experimenten im Sachunterricht. In Zeitschrift Grundschulunterricht (Bd. 05/2006, S. S. 31-34). Oldenburg-Verlag.
Peschel, M. (2011). Der Lernstick und die Schulfächer – Versuch einer Übersicht. In H. - U. Grunder (Hrsg.), mLearning in der Schule (S. 51-72). Baltmannsweiler: Schneider-Verlag Hohengehren.
Peschel, M., Weißer, P., & Schäfer, J.. (2010). Der Zucker nimmt die Tinte Huckepack. – Kooperationen zwischen Schule und Universität. In Sache – Wort – Zahl (SWZ) (Heft 112, 09/2010, 38. Jhg., S. 48-56). Aulis Verlag.
PDF icon Peschel (2010) Der Zucker nimmt die Tinte Huckepack.PDF (1.55 MB)
Peschel, M. (2003). Die "Dichterlesung". Ein Element der schriftlichen Kommunikation beim Schriftspracherwerb mit "Lesen durch Schreiben". In A. Panagiotopoulou & Brügelmann, H. (Hrsg.), Grundschulpädagogik meets Kindheitsforschung. Zum Wechselverständnis von schulischem Lernen und außerschulischen Erfahrungen im Grundschulalter (Jahrbuch Grundschulforschung., S. 145-149).
PDF icon Peschel, Carell (2012). Die Internetplattform kidipedia im Unterricht sinnvoll nutzen.pdf (136.3 KB)
Peschel, M., & Carell, S.. (2010). Die Materialsammlung im Grundschullabor für Offenes Experimentieren. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 461-463). Berlin: LIT. Abgerufen von
PDF icon PeschelCarell (2010) Das Materialkonzept.pdf (5.36 MB)
Peschel, M. (2018). Digitales Lernen vs. analoges Lernen – Digitale Bildung in einer analogen Welt oder: Bildung für eine Welt mit digitalen Medien. In Wozu brauchen wir digitale Medien? (Grundschule aktuell., Bd. 142, S. 12-15). Frankfurt am Main: Grunndschulverband. Abgerufen von
Peschel, M. (2002). Du schreibst, Ich lese! - Lesen und Schreiben lernen mit Text-To-Speech-Software. In T. Fitzner (Hrsg.), Alphabetisierung und Sprachenlernen. Klett.
Fischer, H. - J., Giest, H., & Peschel, M.. (2014). Editional. In H. - J. Fischer, Giest, H., & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 24, S. 9-16). Bad Heilbrunn: Klinkhardt.
Giest, H., & Peschel, M.. (2014). Editional. In H. Giest & Peschel, M. (Hrsg.), GDSU-Journal (Bd. 4, S. 7-8). GDSU. Abgerufen von
PDF icon Weber, A. (2016). Ein Baum - Lebewesen und Lebensraum.pdf (547.12 KB)
Carell, S., & Peschel, M.. (2015). Einfluss des Onlinelexikons kidipedia auf die Naturwissenschaftskompetenz von Jungen und Mädchen an Schweizer Primschulen. In D. Blömer, Lichtblau, M., Jüttner, A. - K., Koch, K., Krüger, M., & Werning, R. (Hrsg.), Perspektiven auf inklusive Bildung – Gemeinsam anders lehren und lernen (Jahrbuch Grundschulforschung., Bd. 18, S. 216-223). Wiesbaden: Springer VS. Abgerufen von
PDF icon Carell, Peschel (2015). Einfluss des Onlinelexikons kidipedia...pdf (662.42 KB)
Peschel, M., Favre, P., & Mathis, C.. (2013). Einleitung. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten - Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts - Kinder.Sachen.Welten., S. 5-6). Baltmannsweiler: Schneider-Verlag.
Peschel, M., Kihm, P., Scherer, N., & Kelkel, M.. (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe. In LeLa Magazin (17. Aufl., Bd. März 2017, S. 12-13).
PDF icon Peschel, Kelkel, Kihm, Scherer (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe..pdf (385.46 KB)
Peschel, M. (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht. In C. Maurer (Hrsg.), Authentizität und Lernen - das Fach in der Fachdidaktik (Gesellschaft für Didaktik der Chemie und Physik., S. 373-375). Universität Regensburg.
PDF icon Peschel, M. (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht (597.17 KB)
Peschel, M. (2016). Entwicklung der selbst eingeschätzten Kompetenzen in der Sachunterrichtsausbildung im Saarland. In H. Giest, Goll, T., & Hartinger, A. (Hrsg.), Sachunterricht – zwischen Kompetenzorientierung, Persönlichkeitsentwicklung, Lebenswelt und Fachbezug (Probleme und Perspektiven des Sachunterrichts., Bd. 26, S. 149-157). Bad Heilbrunn: Klinkhardt.
Peschel, M., & Carell, S.. (2013). Entwicklungen in der Medienpädagogik von Mosaik (1992/1993) zu kidipedia (2012) – zukunftsfähige Konzeption für den Sachunterricht?. In H. - J. Fischer, Giest, H., & Pech, D. (Hrsg.), Der Sachunterricht und seine Didaktik – Bestände prüfen und Perspektiven entwickeln (Bd. 23, S. 121-128). Bad Heilbrunn: Klinkhardt (= Probleme und Perspektiven des Sachunterrichts. 23).
Diehl, A., & Peschel, M.. (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren. In C. Maurer (Hrsg.), Authentizität und Lernen - das Fach in der Fachdidaktik (Gesellschaft für Didaktik der Chemie und Physik., Bd. 36, S. 515-517). Universität Regensburg.
PDF icon Peschel, M. & Diehl, A. (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren (563 KB)
Kelkel, M., & Peschel, M.. (2018). Fachlichkeit in Lernwerkstätten. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (S. 15-34). Bad Heilbrunn: Klinkhardt.
Schumacher, A., & Peschel, M.. (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren (GOFEX). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (S. 545-547). Kiel: IPN. Abgerufen von
PDF icon Peschel, Schumacher (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren .pdf (919.59 KB)
Carell, S., & Peschel, M.. (2013). Forschendes Lernen im Web 2.0 - kidipedia. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik (Bd. 33, S. 560–562). Kiel: IPN. Abgerufen von
PDF icon Peschel, Carell (2013). Forschendes Lernen im Web 2.0 - kidipedia.pdf (785.23 KB)
Peschel, M., Köster, H., & Zimmermann, M.. (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht. In S. Bernhold (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (S. 542-544). Kiel: IPN. Abgerufen von
PDF icon Peschel, Köster, Zimmermann (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht.pdf (693.6 KB)
Carle, U., & Peschel, M.. (2017). Forschung für die Praxis – Plädoyer für schulpraktisch relevante Forschung. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Beiträge zur Reform der Grundschule., Bd. 143, S. 8-19). Frankfurt am Main: Grundschulverband e.V. Abgerufen von
Peschel, M., & Struzyna, S.. (2010). GOFEX - Grundschullabor für Offenes Experimentieren: Entwicklung eines Raumkonzeptes als Element der Öffnung. In K. - H. Arnold, Hauenschild, K., Schmidt, B., & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung ((Jahrbuch Grundschulforschung., Bd. 14, S. 197-200). Wiesbaden: VS-Verlag.
PDF icon Peschel, M., Struzyna, S. (2010). GOFEX : Entwicklung eines Raumkonzeptes als Element der Öffnung (1.52 MB)
Peschel, M. (2009). GOFEX – Grundschullabor für Offenes Experimentieren. Grundlegende Konzeption. In R. Lauterbach, Giest, H., & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 229-236). Bad Heilbrunn: Klinkhardt.
PDF icon Peschel (2009) GOFEX. Grundlegende Konzeption.pdf (528.97 KB)
Peschel, M. (2008). GOFEX – Grundschullabor für Offenes Experimentieren. In Didaktik der Physik. Regensburg, Berlin: Lehmanns Media -
Peschel, M. (2013). GOFEX – Ort des Lehrens und Lernens. In E. Wannack, Bosshart, S., Eichenberger, A., Fuchs, M., Hardegger, E., & Marti, S. (Hrsg.), 4-12-jährige – Ihre schulischen und außerschulischen Lern- und Lebenswelten (S. 260-268). Münster, New York, München, Berlin: Waxmann.
PDF icon Peschel, M. (2013) GOFEX - Ort des Lehrens und Lernens.pdf (1.81 MB)
PDF icon Schumacher, Kelkel, Dicato, Diederich (2011).Gold from the sea: Marine compounds as inhibitors of the hallmarks of cancer.pdf (1.92 MB)
Irion, T., & Peschel, M.. (2016). Grundschule und neue Medien - Neue Entwicklungen. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 11-15). Grundschulverband.
Peschel, M. (2010). Grundschullabor für Offenes Experimentieren – Grundschultransfer?. In H. Giest & Pech, D. (Hrsg.), Anschlussfähige Bildung im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 20, S. 49-57). Heilbrunn: Klinkhardt.
PDF icon Peschel. M. (2010) GOFEX - Grundschultransfer?.pdf (9.28 MB)
Peschel, M. (2013). Gute Aufgaben für forschendes Lernen im experimentierenden Sachunterricht. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung Hannover 2012 (Bd. 33, S. 128–130). Kiel: IPN. Abgerufen von
PDF icon Peschel (2013). Gute Aufgaben für Forschendes Lernen im experimentierenden Sachunterricht.pdf (697.91 KB)
Peschel, M. (2012). Gute Aufgaben im Sachunterricht - Offene Werkstätten = Gute Aufgaben?. In U. carle & Kosinar, J. (Hrsg.), Aufgabenqualität in der Grundschule (S. 161-172). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Peschel, M. (2012) Gute Aufgaben im Sachunterricht.pdf (1.84 MB)
Peschel, M. (2014). Individuelle Förderung beim naturwissenschaftlichen Lernen im Sachunterricht der Grundschule. In (Zeitschrift für Grundschulforschung., Bd. 2-2014, S. 146-160). Bad Heilbrunn: Klinkhardt.
Peschel, M. (2016). Inklusive Mediendidaktik in der Grundschule. In G. Erziehung Wissenschaft (Hrsg.), Erfolgreich mit Neuen Medien! - Was bringt das Lernen im Netz? (S. 33-36). Frankfurt a.M.: GEW. Abgerufen von
PDF icon 2016_Peschel_Inklusive Mediendidaktik in der Grundschule.pdf (646.26 KB)
Kihm, P., & Peschel, M.. (2017). Interaktion und Kommunikation beim Experimentieren von Kindern – Eine Untersuchung über interaktions- und kommunikationsförderliche Aufgabenformate. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Beiträge zur Reform der Grundschule., Bd. 143, S. 68-80). Frankfurt am Main: Grundschulverband e.V. Abgerufen von
Schirra, S., Peschel, M., & Scherer, N.. (2018). „kidi on tour“ – Mobile Learning und das Potenzial digitaler Geomedien zur Vermittlung digitaler Raum-Zeitlichkeit am Beispiel von GOFEX und kidipedia. In Jahrbuch Medienpädagogik 14. Der digitale Raum – Medienpädagogische Untersuchungen und Perspektiven (S. 157-175). Wiesbaden: Springer VS.
PDF icon Peschel, M., Schirra, S., Scherer, N. (2018). kidi on tour-Mobile Learning und das Potenzial digitaler Geomedien (...) (843.24 KB)
Schirra, S., & Peschel, M.. (2018). kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen.. In EuWiS. Zeitung ‚Erziehung und Wissenschaft im Saarland’ des Landesverbandes der GEW im DGB (S. 13-14). Abgerufen von
PDF icon kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen. (8.91 MB)
Peschel, M. (2011). kidipedia – Ein Onlinelexikon von Kids für Kids. In H. Giest, Kaiser, A., & Schomaker, C. (Hrsg.), Sachunterricht - auf dem Weg zur Inklusion (Probleme und Perspektiven des Sachunterrichts., Bd. 21, S. 193-198). Bad Heilbrunn: Klinkhardt.
PDF icon Peschel (2011). kidipedia - Ein Onlinelexikon von Kids für Kids.pdf (373.11 KB)
Peschel, M., Schirra, S., & Carell, S.. (2016). kidipedia - Ein Unterrichtsvorschlag. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Dimensionen des Sachunterricht - Kinder.Sachen.Welten., Bd. 7, S. 65-78). Baltmannsweiler: Schneider-Verlag Hohengehren. Abgerufen von
PDF icon Schirra, Warken, Peschel (2015). kidipedia-Einsatz eines (audio-)visuellen Bildungsmediums im geographisch-orientierten Sachunterricht.pdf (3.27 MB)
Carell, S., & Peschel, M.. (2014). kidipedia – Ergebnisse eines Forschungsprojektes im Sachunterricht. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 489-491). Kiel: IPN. Abgerufen von
PDF icon Peschel, Carell (2014). kidipedia - Ergebnisse eines Forschungsprojekts im Sachunterricht.pdf (1.34 MB)
Peschel, M. (2010). kidipedia – Präsentieren von Sachunterrichtsergebnissen im Internet. In M. Peschel (Hrsg.), Neue Medien im Sachunterricht (S. 71-78). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Peschel (2010) kidipedia - Präsentieren von Sachunterrichtsergebnissen im Internet.pdf (706.07 KB)
Peschel, M., & Carell, S.. (2012). Kidipedia - Unterstützungsangebot für Mädchen & Jungen im Sachunterricht. In S. Bernholt (Hrsg.), Konzepte fachdidaktischer Strukturierung für den Unterricht (Bd. 32, S. S. 464-467). Berlin : LIT.
Peschel, M. (2010). – Eine Präsentationsplattform im Internet für Sachunterrichtsergebnisse. In K. - H. Arnold, Hauenschild, K., Schmidt, B., & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (Jahrbuch Grundschulforschung., Bd. 14, S. 193-196). Wiesbaden: VS-Verlag.
Kihm, P., Diener, J., & Peschel, M.. (2018). Kinder forschen – Wege zur (gemeinsamen) Erkenntnis. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. (Lernen und Studieren in Lernwerkstätten., S. 66-84). Bad Heilbrunn: Klinkhardt.
Schirra, S., & Peschel, M.. (2017). Kinder kindgerecht an digitale Medien heranführen. In KiTa aktuell. Fachzeitschrift für Leitungen, Fachkräfte und Träger der Kindertagesbetreuung (Bd. 25, S. 112-114).
Peschel, M. (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN. In R. Lauterbach, Hartinger, A., Feige, B., & Cech, D. (Hrsg.), Kompetenzerwerb im Sachunterricht fördern und erfassen (Bd. 17, Probleme und Perspektiven des Sachunterrichts, S. 151-160).
PDF icon Peschel,M. (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN..pdf (713.99 KB)
Peschel, M. (2006). LDS im Werkstattunterricht. Defintion und Abgrenzung. In R. Hinz & Pütz, T. (Hrsg.), Professionelles Handeln in der Grundschule (Entwicklungslinien der Grundschulpädagogik., Bd. 3, S. 159-166). Baltmannsweiler: Schneider-Verlag Hohengehren.
Peschel, M., & Koch, A.. (2014). Lehrertypen – Typisch Lehrer?! Clusterungen im Projekt SUN. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 216-218). Kiel: IPN. Abgerufen von
PDF icon Peschel, Koch (2014). Lehrertypen-Typisch Lehrer? Clusterungen im Projekt SUN (1.27 MB)
Hildebrandt, E., Peschel, M., & Weißhaupt, M.. (2014). Lernen zwischen freiem und instruiertem Tätigsein – Eine Einführung. In E. Hildebrandt, Peschel, M., & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (1. Aufl., S. 9-13). Bad Heilbrunn: Klinkhardt. Abgerufen von
PDF icon Peschel (2016). Lernkulturen in der Grundschule und im Sachunterricht.pdf (414.61 KB)
Peschel, M., & Meiers, K.. (2015). Lesen im Sachunterricht. In Sache Wort Zahl. Lehren und Lernen in der Grundschule, Heft Nr. 150-151/43. Jahrgang Juni 2015 (S. 60-69). Hallbergmoos: Aulis.
Peschel, M. (2010). Luft und Vakuum. Experimente mit Luft..und ohne!. In Sache – Wort – Zahl (SWZ) (Bd. Heft 108, 03/2010, 38. Jhg., S. 23 - 25). Aulis Verlag.
PDF icon Peschel (2010) Luft und Vakuum.PDF (748.87 KB)
Peschel, M. (Hrsg.). (2011). Macht der Mond die Nacht? - Tag und Nacht im Kindergarten. In Weltwissen Sachunterricht (Bd. Heft 03/2011, S. 6-7). Westermann-Verlag. Abgerufen von
PDF icon Peschel, M.(2011). Macht der Mond die Nacht? (1.09 MB)
Peschel, M., & Herrmann, C.. (2010). Materialaspekt im Sachunterricht - Einflüsse des Materials auf die physikalischen Anteile des Sachunterrichts. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 455-457). Berlin: LIT. Abgerufen von
Peschel, M. (2016). Mediales Lernen - Eine Modellierung als Einleitung. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Dimensionen des Sachunterricht - Kinder.Sachen.Welten., Bd. 7, S. 7-16). Baltmannsweiler: Schneider-Verlag Hohengehren. Abgerufen von
Gervé, F., & Peschel, M.. (2013). Medien im Sachunterricht. In E. Gläser & Schönknecht, G. (Hrsg.), Sachunterricht in der Grundschule (S. 58-79). Arbeitskreis Grundschule – Der Grundschulverband.
PDF icon Peschel (2012). Mediendidaktik, Medienkompetenz, Medienerziehung - Web 2.0 Aktivitäten im Sachunterricht.pdf (86.21 KB)
Peschel, M. (2014). Medienerziehung. In A. Hartinger & Lange, K. (Hrsg.), Sachunterricht – Didaktik für die Grundschule (S. 158-169). Berlin: Cornelsen Scriptor. Abgerufen von
Peschel, M. (2015). Medienerziehung im Sachunterricht. In J. Kahlert, Fölling-Albers, M., Götz, M., Miller, S., & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts. (S. 173-179). Bad Heilbrunn: Klinkhardt. Abgerufen von
Peschel, M. (2011). Medienerziehung und schulische Sozialerziehung. In M. Limbourg & Steins, G. (Hrsg.), Sozialerziehung in der Schule (S. 451-474). VS-Verlag.
Peschel, M. (2016). Medienlernen im Sachunterricht - Lernen mit Medien und Lernen über Medien. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 33-49). Frankfurt a.M.: Grundschulverband.
Schröder, C.. (2011). “Mit vereinten Kräften voran”. Social Development in einem Kooperationsprojekt einer transnationaeln NGO und einer loken NGO. In Soziale Arbeit als Entwicklungszusammenarbeit. Baltmannsweiler: Schneider Hohengehren.
Carell, S., & Peschel, M.. (2014). Motivations- und Interessenveränderungen bei der Arbeit mit In H. - J. Fischer, Giest, H., & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 24, S. 79-86). Bad Heilbrunn: Klinkhardt.
PDF icon Cerella, Kelkel, Viry, Dicato, Jacob, Diederich (2011). Naturally Occurring Organic Sulfur Compounds: An Example of a Multitasking Class of Phytochemicals in Anti-Cancer Research..pdf (711.62 KB)
Peschel, M. (2009). Naturwissenschaftliche Aus- und Fortbildung für den Sachunterricht – Ergebnisse aus dem Projekt SUN zum physikbezogenen Sachunterricht. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 143-145). Berlin: LIT.
Peschel, M., & Kihm, P.. (2019). Naturwissenschaftliche Phänomene im Grundschullabor für Offenes Experimentieren (GOFEX) entdecken. In Zeitschrift "Erziehung und Wissenschaft im Saarland" des Landesverbandes der GEW im DGB (02/2019. Aufl., Bd. 65. Jahrgang , S. 14-15).
PDF icon Peschel, Kihm (2018). Naturwissenschaftliche Phänomen im Grundschullabor für Offenes Experimentieren entdecken..pdf (846.91 KB)
Peschel, M. (2016). Neue Medien in der Grundschule 3.0. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 189-192). Grundschulverband.
PDF icon Peschel (2010).Neue Medien in Forschung und Praxis. Ergebnisse aus der Arbeitsgruppe AG Neue Medien (ICT) im Sachunterricht GDSU.PDF (228.35 KB)
Peschel, M., & Carell, S.. (2010). Nutzungsweise computergestützter Medien – Unterschiede zwischen Jungen und Mädchen?!. In Neue Medien im Sachunterricht (S. 79-86). Baltmannsweiler: Schneider-Verlag Hohengehren.
Peschel, M. (2015). Offenes Experimentieren - das Projekt SelfPro. In H. - J. Fischer, Giest, H., & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 25, S. 59-64). Bad Heilbrunn: Klinkhardt. Abgerufen von
Peschel, M. (2008). Offenes Experimentieren – Eine Chance für Jungen und Mädchen!. In J. Ramsberger & Ramsberger, W. (Hrsg.), Chancengleichheit in der Grundschule. Ursachen und Wege aus der Krise (Bd. 12, Jahrbuch Grundschulforschung). Wiesbaden: VS Verlag für Sozialwissenschaften.
PDF icon Peschel, M. (2008) Offenes Experimentieren - Eine Chance für Jungen und Mädchen.pdf (88.68 KB)
Peschel, M. (2016). Offenes Experimentieren – Individuelles Lernen: Aufgaben in Lernwerkstätten. In H. Hahn, Esslinger-Hinz, I., & Panagiotopoulou, A. (Hrsg.), Paradigmen und Paradigmenwechsel in der Grundschulpädagogik (S. S. 120-131). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Peschel (2016) Offenes Experimentieren – individuelles Lernen.pdf (7.26 MB)
Peschel, M. (2013). Perspektivenvernetzender Themenbereich Medien. In Perspektivrahmen Sachunterricht (S. 83–85). Bad Heilbrunn: Klinkhardt.
Schröder, C.. (2013). Politische Umbrüche und Soziale Arbeit in der Maghreb-Maschrek-Region. In Weltatlas Sozialen Arbeit - Jenseits aller Vermessungen (S. 32-51). Weinheim; Basel: Beltz Juventa.
PDF icon Kelkel, Jacob, Dicato, Diederich (2010).Potential of the Dietary Antioxidants Resveratrol and Curcumin in Prevention and Treatment of Hematologic Malignancies.pdf (792.79 KB)
Schröder, C.. (2013). Quién define lo que es el FSM? . In (Foro Social Mundial: ¿Momento de replanteamientos?).
PDF icon Online verfügbar unter (861.14 KB)
Schirra, S., & Peschel, M.. (2016). Recherchieren, Dokumentieren und Präsentieren mit kidipedia im Zeitalter von Tablets & Co. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 235-246). Frankfurt a.M.: Grundschulverband.
Huwer, J., Lauer, L., Seibert, J., Thyssen, C., Dörrenbächer-Ulrich, L., & Perels, F.. (2018). Re-Experiencing Chemistry with Augmented Reality: New Possibilities for Individual Support. In World Journal of Chemical Education (5. Aufl., Bd. 6, S. 212-217). doi:10.12691/wjce-6-5-2
PDF icon Online verfügbar unter (398.73 KB)
PDF icon Kelkel, Cerella, Mack, Schneider, Jacob, Schumacher, Diacto, Diederich (2012). ROS-independent JNK activation and multisite phosphorylation of Bcl-2 link diallyl tetrasulfide-induced mitotic arrest to apoptosis.pdf (2.44 MB)
Peschel, M., Favre, P., & Mathis, C.. (2013). Sachunterricht im Wandel. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten - Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Bd. Dimensionen des Sachunterrichts - Kinder.Sachen.Welten, S. 7-20). Baltmannsweiler: Schneider-Verlag.
Peschel, M. (2006). Sachunterricht und Lautorientierter Schriftspracherwerb. In R. Hinz & Schumacher, B. (Hrsg.), Auf den Anfang kommt es an: Kompetenzen entwickeln - Kompetenzen stärken (S. S. 67-76). Wiesbaden: VS Verlag für Sozialwissenschaften. Abgerufen von
PDF icon Peschel (2006). Sachunterricht und Lautorientierter Schriftspracherwerb.pdf (150.25 KB)
Mathis, C., & Peschel, M.. (2013). Sachunterrichtsstudium für die Vorschul- /Primarstufe an der Pädagogischen Hochschule FHNW. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten - Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts - Kinder.Sachen.Welten., S. 67-82). Baltmannsweiler: Schneider-Verlag.
Peschel, M. (2008). Schriftanlässe – Anlässe zum Schreiben. In Grundschule Deutsch (Bd. 02/2008). Oldenburg-Verlag.
PDF icon Peschel, M. (2008). Schriftanlässe. Kommunikation im Schriftspracherwerb..pdf (5.57 MB)
Peschel, M. (2002). Schriftmaschine Computer. In Grundschule (Bd. 01/2002). Westermann.
Peschel, M., & Lang, M.. (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. In GDSU-Journal 7 (S. S.65-77). GDSU.
PDF icon Peschel, Lang (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. (360.19 KB)
Schneider, T., Baldauf, A., Schneider, M., Burkholz, T., Kelkel, M., & Jacob, C.. (2011). Selective Antimicrobial Activity Associated with Sulfur Nanoparticles. In Journal of Biomedical Nanotechnology (3. Aufl., Bd. 7, S. 395405). doi:10.1166/jbn.2011.1293
PDF icon Schneider et al. (2011).Selective Antimicrobial Activity Associated with Sulfur Nanoparticles.pdf (1.28 MB)
Peschel, M. (2017). SelfPro: Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offenen Experimentieren. In S. Miller, Holler-Nowitzki, B., Kottmann, B., Lesemann, S., Letmathe-Henkel, B., Meyer, N., u. a. (Hrsg.), Profession und Disziplin - Grundschulpädagogik im Diskurs (Jahrbuch Grundschulforschung., Bd. 22, S. 191-196). Wiesbaden: Springer VS. Abgerufen von
PDF icon Peschel (2017). SelfPro.Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offen Experimentieren.pdf (282.7 KB)
ValiZadeh, M., & Peschel, M.. (2018). SelfPro – Entwicklung von Selbstkonzepten beim Offenen Experimentieren. In U. Franz, Giest, H., Hartinger, A., Heinrich-Dönges, A., & Reinhoffer, B. (Hrsg.), Handeln im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 28, S. 183-190). Bad Heilbrunn: Klinkhardt.
Peschel, M., & Giest, H.. (2009). Spielen am Computer - Chancen für den Sachunterricht. In Grundschulunterricht – Sachunterricht (Bd. 02/2009, S. 33-37). Oldenbourg-Verlag.
PDF icon Peschel, M., Giest, H. (2009). Spielen am Computer-Chancen für den Sachunterricht (989.62 KB)
PDF icon Schumacher, Kelkel, Dicato, Diederich (2011). A Survey of Marine Natural Compounds and Their Derivatives with Anti-Cancer Activity Reported in 2010.pdf (2.1 MB)
Czepukojc, B., Baltes, A. - K., Cerella, C., Kelkel, M., Viswanathan, U. Maheswari, Salm, F., u. a.. (2013). Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells. In Food and chemical toxicology: an international journal published for the British Industrial Biological Research Association 64.
PDF icon Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells (1.23 MB)
Schröder, C., & Homfeldt, H. Günther. (2013). Transnationales Wissen in NGOs. In Transnationales Wissen und Soziale Arbeit. Weinheim; Basel: Beltz Juventa.
Peschel, M., & Bürger, C.. (2009). Unterrichtsbedingungen für physikalischen Sachunterricht (SUN). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 428-430). Berlin: LIT.
Peschel, M. (2013). Vergleichen und Recherchieren. In (Hrsg.), Perspektivrahmen Sachunterricht (S. 148–152). Bad Heilbrunn: Klinkhardt.
Peschel, M. (2014). Vom instruierten zum Freien Forschen – Selbstbestimmungskonzepte im GOFEX. In E. Hildebrandt, Peschel, M., & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (Lernen & Studieren in Lernwerkstätten - Impulse für Theorie und Praxis einer innovativen Lehrerbildung., Bd. 1, S. 67-79). Bad Heilbrunn: Klinkhardt.
PDF icon Peschel (2014) Selbstbestimmung im GOFEX.pdf (109.44 KB)
Schirra, S., & Peschel, M.. (2017). Von Kids für Kids: Lernplattform kidipedia. Mediale und geografische Kompetenzen fördern. In Grundschulunterricht. Sachunterricht (Bd. 02/2017, S. 17-20).
Schirra, S., & Peschel, M.. (2016). Was geht? Neue Medien im Sachunterricht. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 309-315). Frankfurt a.M.: Grundschulverband.
Peschel, M., & Struzyna, S.. (2007). Wer unterrichtet unsere Kinder? SUN – Sachunterricht in Nordrhein- Westfalen. In K. möller, Hanke, P., Beinbrech, C., Hein, A., Kleickmann, T., & Schages, R. (Hrsg.), Qualität von Grundschulunterricht entwickeln, erfassen und bewerten (Bd. 11, Jahrbuch Grundschulforschung, S. 171-174). Bonn: Verlag für Soialwissenschaften.
PDF icon Peschel, M., Struzyna, S. (2007). Wer unterrichtet unserer Kinder? (111.99 KB)
Schröder, C.. (2013). Who defines what the World Social Forum is?. In (Foro Social Mundial: ¿Momento de replanteamientos?).
PDF icon Online verfügbar unter (128.25 KB)
Peschel, M., & Kelkel, M.. (2018). Zur Sache!. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (S. 9-14). Bad Heilbrunn: Klinkhardt.
Peschel, M. (Hrsg.). (2016). Mediales Lernen – Beispiele für eine inklusive Mediendidaktik. Baltmannsweiler: Schneider-Verlag Hohengehren. Abgerufen von
Universitäre Publikationen
Diehl, A., & Peschel, M.. (2015). GOFEX - Erneuerbare Energien. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung - Festschrift, 43. Abgerufen von
Kelkel, M., Peschel, M., & Urig, N.. (2016). GOFEX_EE - Erneuerbare Energien im praktischen Test. LeLa BNE Broschüre "Bildung für nachhaltige Entwicklung in Schülerlaboren", 62-65. Abgerufen von
Peschel, M. (2008). kidipedia - Ein Wikipedia für Kids. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung - Empirische Lehr-Lern-Forschung, 70-72.
Peschel, M. (2015). Konzeption des Grundschullabors für Offenes Experimentieren (GOFEX) - Elemente der Öffnung. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung - Festschrift, 122-123. Abgerufen von
Peschel, M. (2006). Lehrvoraussetzungen und Professionswissen von Lehrenden im Sachunterricht der Grundschule. (A. Pitton, Hrsg.)Fachdidaktische Forschung - Empirische Lehr-Lern-Forschung. Essen, 88ff.
Lang, M., & Peschel, M.. (2015). SINUS trifft GOFEX. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung - Festschrift, 79. Abgerufen von
Peschel, M. (2008). SUN: Erhebung der Lehrvoraussetzungen und des Professionswissens von Lehrenden im Sachunterricht der Grundschule. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung - Empirische Lehr-Lern-Forschung, 68-70.
Peschel, M. (2011). Wege zum Offenen Experimentieren. (K. Scheler, Hrsg.)Wissenschaft trifft Praxis - Bericht von der Expertentagung zur frühen naturwissenschaftlichen Bildung, (Forscherstation - Heidelberg), 48-54.
PDF icon Wegweiser WiSe 2014/15 (735.13 KB)
Weitere Publikationen
PDF icon kleines3x3zuSmartKids.pdf (2.54 MB)
Peschel, M., & Streit, C.. (2011). Lern-Atelier in Solothurn eröffnet. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. (2005). Lernchance Computer?. Tagungsband der Hans-Böckler-Stiftung.
Peschel, M., & Schumacher, A.. (2012). Neue Wege beim Experimentieren. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M., & Streit, C.. (2012). Physik und Mathe können lustvoll gelernt werden. Bildungsseite der Aargauer Zeitung und der Basler Zeitung.

Projekte im Fokus

Das Grundschullabor für Offenes Experimentieren (GOFEX, hat das Ziel, das...

Projekte im Fokus

GeAR – Gelingensbedingungen und Grundsatzfragen von Augmented Reality in experimentellen Lehr-...
Go to top